SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10000010m|PACid:20208455 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10000010m|PACid:20208455
Domain Number 1 Region: 809-904
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-23
Family B3 DNA binding domain 0.0048
Further Details:      
 
Domain Number 2 Region: 1225-1320
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-22
Family B3 DNA binding domain 0.0046
Further Details:      
 
Domain Number 3 Region: 359-457
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-22
Family B3 DNA binding domain 0.016
Further Details:      
 
Domain Number 4 Region: 64-164
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-22
Family B3 DNA binding domain 0.0071
Further Details:      
 
Domain Number 5 Region: 648-747
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.87e-21
Family B3 DNA binding domain 0.0073
Further Details:      
 
Domain Number 6 Region: 1380-1478
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-19
Family B3 DNA binding domain 0.0065
Further Details:      
 
Domain Number 7 Region: 200-295
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.83e-18
Family B3 DNA binding domain 0.0095
Further Details:      
 
Domain Number 8 Region: 1085-1162
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000275
Family B3 DNA binding domain 0.0089
Further Details:      
 
Weak hits

Sequence:  Thhalv10000010m|PACid:20208455
Domain Number - Region: 962-991
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0569
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10000010m|PACid:20208455
Sequence length 1486
Sequence
MVLHLSDLGPSSNNDQDKMGYISMKKHQHPRSEDYGGDDDNTELARKKKAKMNKSEAEAD
SSSSDHSCFVALVTASNLHTDALYLPKDFTSSNVLKRECRKIVLTDGGERSWALDLRFNK
SCDSFYITRGWRSFCEENGRKEGGFFVFKLVGNSETPFLSFCSTESFNDGTNKNSKESCM
ELERKKNHLRCIDSTSPIENRFVTLTLPQCSLRDSRIFIPLPFLRENDLDKPRLITLLGK
DGTKQVADLRRDGSGRMRLTKGWREFAKANGLKAGESFTLESIWKDKTPMLRLVHTDSSS
DGRQQRQCYSKASEKESVSTESRREKASKKVSPLSSGKQISKEERKKNHLRFRDSPSPSQ
NPFVTLTVTHDSLRNCRLHLPLSFMRKNGLDKSGMITLLGKDGTKWPANLLRENATGRMS
LGKGWKDFAIANSVKAGESFTLKSLWKDKTPMLSLVHTDSSSDGRQQGQCYSKASEKESV
STEPSGENKTQGAKNNREEKRHSSSGIGNQFVTLTLKPEDVRDCKLNKSWASYEVRRIQR
FPHRSRTHCRLKIVRCDAHDLRIRKVVVFLRHGRRYDVPEFTRKKKTKKNNPETEAFSTS
DHSCFEAHVSATNCLDFRLQDSTSSDAIRKKCDKKYSSRRMVKSYESSEKRFVTFTLAPV
DVRHCRLRLPMQFSRENGINKPGKIYLLGNDGSKWLANLLLESRGRMTVGDGWKSFVKAN
GLKIGESYTLELKWEDTTPVLCLCPEEYSMYRGAGGCSEASEKESLLIQPSSGNEIMTIE
NIDENRKEESSSWEKEKNHLRRSDSTSTSQNRFLTLTITPDSLRHGRLRIPLQFMRENRM
NTPGDITLLGKDGAKWLVSLLLERRGRMSLGKGWKDFAKANGLKTGDSITLESIWEDATP
VLSLLRIEPNSDGRQQGEYSIAREKETIFTELSSGESRKYPLGRLDSSLAIQSTVSPEIG
VSHHLRIGEIAVFRHEGDMMFQVSDFGPSCCEIRDVLTPIRNHYQENIELPRKKKVKLNN
PGTEAVFSSDRSCFVAHVTASNLHTNALPLPQEPLPQDFSSSDGHNRKCPKNSPTQIISS
YSSNEKHLATFTLAPVNVRNCRLRLPMQFTRENGINKPGKIYLLGKDGSKWLANLLQESR
GRMTLGDGWKSFVTANGLKTEYSIDSREEGGCPEAREKEPLPIKPSSGKEISISYNNEDE
NSKEESTSWEREKNQLISSNSSSPSQNRFLTLTITPDSLRHGRLRLPLQFMRENSMNTPG
DITLLGKDGAKWLVSLLLERRGRMSLGKGWKDFAKANGLKTGDSITLESIWEDATPVLSL
LRIEASNDRGQSEFSKLSLSTGRSSGNKTRKAENNREGSSSGEFEKSKDLLRRVHSSLAI
QNRIVMLTLTPEDVRDCKLHLPSQFMRTNGITKPGKITMLGRSGMKWFAYLLSNDGAVAL
GNGWKGFCEANGVMVGESYILEYIPREDTDHVFKFCSNFGDQIHNW
Download sequence
Identical sequences V4LVD4
Thhalv10000010m|PACid:20208455 XP_006405009.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]