SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10000130m|PACid:20208871 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10000130m|PACid:20208871
Domain Number 1 Region: 147-242
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.87e-22
Family B3 DNA binding domain 0.0084
Further Details:      
 
Domain Number 2 Region: 275-371
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-21
Family B3 DNA binding domain 0.011
Further Details:      
 
Domain Number 3 Region: 10-109
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-19
Family B3 DNA binding domain 0.0047
Further Details:      
 
Domain Number 4 Region: 417-514
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.2e-16
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10000130m|PACid:20208871
Sequence length 515
Sequence
MANPPLYSPIKPHFFQPLLPGFTNHLDIPVAFFLKHLEGSNKGKTAKLRSDASEITWKVK
IDGRRLSVGWEDFAVAHDLRIGDIVVFRHEGDLLFHVTALGPSCCEIQYGEYSNDEEENM
EKKICDTEKVSRKKKKSPKTETDDATDQSCFEVTVTASNLKRDVVYLPKTFAEVNGLIKK
SEIVLMNEEGESWKIDLRHEDYSGRFYMSRGWRSFCVANGKKPGDDFTFKLVQNEETPVI
QMLPLNTEDLHKLDSTMDAEKVPKKKCQKTEADSSPDHSCFVAIVTASNLERDTVYLPKK
FAVSNGLLKKREIDLVNEKGKSWRIDLRHVAYPGRFCMRRGWRSFCIANEKKPGDSFKFK
LVQNGETPMLQMFPLNMHKLEPSNDTREGLEATSDVIRQGKRSKAIKTTITEEHSTTSQN
RFVTLTFTPANRLNFPLQFTKENGIKKAGRITMLDRYGTRWKTSLLMNKNQRGTMSLGRN
WKGFCEINGVKMDESFVLELVWEERVPILKFCSKS
Download sequence
Identical sequences V4LRL3
XP_006405016.1.70970 Thhalv10000130m|PACid:20208871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]