SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10000279m|PACid:20208355 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10000279m|PACid:20208355
Domain Number 1 Region: 140-235
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.83e-21
Family B3 DNA binding domain 0.0056
Further Details:      
 
Domain Number 2 Region: 38-133
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.86e-18
Family B3 DNA binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10000279m|PACid:20208355
Sequence length 281
Sequence
MKKGETPLLSFWPSESINDGTQADENNRQGCRDLISPNQNRFVTLTLTNDSLKSSRLYLP
LQFLKENGMDKPGMVTLLGNDGTRRLANLLRESSGRMSLGKGLKDFTKANGLKMGESFTL
ELIWENATPVLRLLSAELRSQNRFVTLTLTHDSFKNSRLGLPLPFMRENGMNQPGTIALL
GKDGTKWMANLLRESQGRMSLGKGWKDFARGNGLEIGESFTLESIWEDATPMLRLSGTVS
KSDRRLQGEHCCEASEKESVIRELNESNIDERSNSSSLVQN
Download sequence
Identical sequences V4M2K0
XP_006405015.1.70970 Thhalv10000279m|PACid:20208355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]