SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10000515m|PACid:20208843 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10000515m|PACid:20208843
Domain Number 1 Region: 136-235
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-19
Family B3 DNA binding domain 0.0055
Further Details:      
 
Domain Number 2 Region: 286-385
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-19
Family B3 DNA binding domain 0.0069
Further Details:      
 
Domain Number 3 Region: 4-104
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.18e-18
Family B3 DNA binding domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10000515m|PACid:20208843
Sequence length 392
Sequence
MAKRHFFQPLLPDFHSHLTIPVAFFSKYIKGKNEHKTTAKLRSDASEITWRVKVEDGRRL
TDGWKEFALAHDFRIGDIVIFRQEKDMTFHVTPFGPSCCEIQYESCLDDENKLEKIPKKK
KRVKREAESSSSLNPSCFVANVTHASLRYDSLSLPMSFARANGLNTRCGEIVLMNDKGRS
WTLALKQKKCGTTYIRRGWRTFCSANGYKAGDFFTLKLIQRGKNLVLRLSLNESEEEEED
DCSLEANDIEPQSDEESNQDERSSQKCSERKHRTGKSTWKASPSPSQNRFVTLTLRPWVV
KNSILFLPMPFTRMNGITEKTKMTLLDKNDVKWPTGLRSGDQGKRIRLVKGWREFFKANN
VKIGESVMLKLIWEGDANCVLKFCSKVKQVTK
Download sequence
Identical sequences V4LVC9
Thhalv10000515m|PACid:20208843 XP_006405004.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]