SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10000608m|PACid:20208283 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10000608m|PACid:20208283
Domain Number 1 Region: 1-96
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000883
Family B3 DNA binding domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10000608m|PACid:20208283
Sequence length 107
Sequence
TNSDINKHCRMLIPKNQMLSVLRKMINVTKESLRNGIEVEVLDIVKNITYFFALRYTDTE
NYFLESRWSAIRQHLDLKAGKVIKLYWDYLNYKFIVLNFANGLISDY
Download sequence
Identical sequences V4M1M3
Thhalv10000608m|PACid:20208283 XP_006404645.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]