SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10000676m|PACid:20208372 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10000676m|PACid:20208372
Domain Number 1 Region: 131-216
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000149
Family B3 DNA binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10000676m|PACid:20208372
Sequence length 218
Sequence
MAEELREIPQVTTGISSNDEVSTSPTKKTEQRAFYLFGARIPFQDSSSLAYKETTYEASK
SCCSSENLNEDGFLAPCLNADSNPEVTCADPKEVTEEASKIKKMRLDFSKEDSKEEEKRT
GVSMNELPLDTWTITKTLTQSDINGSSRLLIPDNQKTIQDGDEVEVRAYDHDTKTEHTIF
LKRIKTTRSYVFQGAWAGEFVRRRRLKEGYKIGLFWNI
Download sequence
Identical sequences V4LRI3
Thhalv10000676m|PACid:20208372 XP_006404981.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]