SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10000689m|PACid:20208748 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10000689m|PACid:20208748
Domain Number 1 Region: 14-114
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000011
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10000689m|PACid:20208748
Sequence length 133
Sequence
KMNYYCEFPVDPAMIILKKLSKSDLIGNVKLPKKQVMSVFKKMEGVTDETLLNGIEVKVL
DLAEANPDTNYKGDEYTVTLRGVDNDKFYFGDGWSTMKYSMDLNEGETLKLYWDYLQGIF
IVLNIPYLVMEEE
Download sequence
Identical sequences V4LR88
Thhalv10000689m|PACid:20208748 XP_006404886.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]