SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10001365m|PACid:20188811 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10001365m|PACid:20188811
Domain Number 1 Region: 109-253
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.19e-40
Family B3 DNA binding domain 0.0055
Further Details:      
 
Domain Number 2 Region: 484-563
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000000231
Family PB1 domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10001365m|PACid:20188811
Sequence length 598
Sequence
MANVDVDFRRSGSYDDQLYMELWKACAGPLVEVPRYGERVFYFPQGHMEQLVALTNQGVV
DQEIPDFNLPPKILCRVLSVMLKAEHETDEVYAQITLQPEEDQSEPTSLDPPLVEPAKQS
VDSFVKILTASDTSTHGGFSVLRKHATECLPSLDMRQPTPTQELVARDLHGYEWRFKHIF
RGQPRRHLLTTGWSTFVTSKRLVAGDAFVFLRGQTGDLRVGVRRLARQQSTMPASVISSQ
SMHLGVLATASHAVNTKTLFVVFYKPRISQFIIGVNKYMAAMKIGFPIGMRFRMRFEGEE
SPERIFTGTIVGTGDLSSQWPASKWRSLQIQWDEPSTVQRPNKVSTWEIEPFSPSVLTPT
PTQPQSKSKRSRPINSSSVSEITGSPIASTFLSLDSNSSLRLLFQDPSTERNSNKPVFPS
GLQCKKTETPVTSCCRLFGFDLMSKPASTAPVPPDKLLISVDSNNSGSAKCQDPNSLTEQ
KQQTSTRSRTKVQKQGTAVGRAVDLTLLRSYDELINELEKMFEIDGELSPKDKWAIVFTD
DEGDMMLVGDDPWNEFCKMAKKLFIYSTDEVKKMSTKSSLDDEGTIVNLELDQRTVYL
Download sequence
Identical sequences V4LHN4
XP_006397845.1.70970 Thhalv10001365m|PACid:20188811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]