SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10003384m|PACid:20208196 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10003384m|PACid:20208196
Domain Number 1 Region: 164-269
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000334
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10003384m|PACid:20208196
Sequence length 276
Sequence
MLTIDLLSDEEDFEAVVTLFQYRQARGDFFENRRTSLTTEEEREAEHEAALGLIELRKTR
AKQQNKKRKANKSQPEEVKLDGQADDEETQKLESKQQNNKKKANKSQPEEVELDGQVIDE
ETQKLEQDNSDDTLKFLSQRNKTKPEKLLFVDVDVVGVRSDSTRKQLNVSDVKVGQIRLL
LGKKHVKKMMLQVIGNSKIIIGLGGIEVSLYRPRSHVFKMLFKMWGGGTPVLSSPKWNKF
VEYYKIKLHCDFVTIWMFRHKETRQICFAVDFIRFP
Download sequence
Identical sequences V4LQF6
XP_006403269.1.70970 Thhalv10003384m|PACid:20208196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]