SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10003545m|PACid:20198526 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10003545m|PACid:20198526
Domain Number 1 Region: 13-599
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.57e-91
Family Acetyl-CoA synthetase-like 0.0000174
Further Details:      
 
Domain Number 2 Region: 798-1158
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.87e-38
Family Quinoprotein alcohol dehydrogenase-like 0.0087
Further Details:      
 
Domain Number 3 Region: 616-678
Classification Level Classification E-value
Superfamily ACP-like 0.00000158
Family Acyl-carrier protein (ACP) 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10003545m|PACid:20198526
Sequence length 1160
Sequence
MTESNRTKSQNRRNCCISHEFVDAASINPDKIAVIHASGWAARIEPEPESLEPFDPPSRT
SSPVYDGDKCFTFAEVSSSIDSLTSRLRRILNVTGHNDPYLIRPRFQGYSLRPYVYIPKV
LALYMPPSVEYIISVFSALRCGEAFLPLDPSWPRERVLSIIASSNVALVIACGSSFDRFG
SKPLERSHWLVGSVVCPMLFFSMSERLSAETGGSSFVWPCNIERQRNFCYLMYTSGSTGK
PKGVCGTEQGLLNRFLWMQKLYPIVGEQQLAFKTSVGFIDHLQEFLGAILNSRPLVIPPF
TLLKENMLSIIDFLEAYSISRLVAVPTMIRAILPSLQYRGHNKLQSCLKLVVLSGEPFPV
SLWDSLHNLLPETCFLNLYGSTEVSGDCTYFDCSELPTLLKTEMIGTVPIGKPISNCKIV
LFGDEDKPCEGDICVGGICLSQGYQHSSIESQGYVKLHNNNSLCNHITNDCGSQLYYRTG
DYGRKLSSGDLIFTGRRDRTVKLNGQRMALEEIETTLELNPDVSEAVVLLNRDQTELASL
EAYLVLNMKTKSDDGIIYAIKNWMREKLPPVMIPNHFVLVESLPSTSSGKVDYEALSRLK
GPRTHAEDMTRTNGSNSLLQTIKKAICDALLVKEVSEDDDFFAIGGDSLAAAHLSHSLGI
DMRLIYQFRSPSKLLIHLSEKERKLTEDMQHITTLKLDHKRESQSGNEFVSRTIPLHSAV
ISDPTPLSEKNVSTKRLKTDSEQFSSERVEEKKTWDLGFSQIQCAFSRCNKVHYPNSCSN
EEGDQENWSVEFPRNDMVSMQELWKVHMESCVDASPLVVLKHSETYVFIGSHSRKFNCID
AKSGSICWETVLEGRIEGSAMVVGDFSQVVVGCYKGKLYFLDFSTGSLCWTFQAGGEIKC
QPVVDTSSQLIWCGSHDHILYALDYRSQRCVYKLQCGGSIFASPIIAEGHSSLYVASTSG
RVIAVSIEDSPFHTLWVLELEAPIFGSLSISPTGQSVICCLVNGQVVAVSPFGTIIWKYM
TGGPIFAGPCMSHVLPSQMLVCCRNGRVYSLEPESGCLVWEYDIGDPITASAYIDENLHF
ESHQLLASDRLVSVCSSTGRVHVLRVRPNIGIDSHEPKVGEIARLDLQADIFSSPVMIGG
RIFIGCRDDYVHCLSLESCR
Download sequence
Identical sequences V4KT57
XP_006395926.1.70970 Thhalv10003545m|PACid:20198526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]