SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10004508m|PACid:20200254 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10004508m|PACid:20200254
Domain Number 1 Region: 184-287
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-30
Family B3 DNA binding domain 0.0000039
Further Details:      
 
Domain Number 2 Region: 65-122
Classification Level Classification E-value
Superfamily DNA-binding domain 3.14e-17
Family GCC-box binding domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10004508m|PACid:20200254
Sequence length 345
Sequence
MDAVSSVDESSTSTDSIHTPAKIPPLTSSRKSSSPASLHRMGSGSSVVLDSDNGVEAESR
KLPSSRFKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEDEAARAYDVAAYRFRGRDAVTNF
TAETNGDKDEVDFLNAHSKSEIVDMLRKHTYKEELEQRKRNRDGNGKRKETAFVTAVTGF
KSAESLFEKAVTPSDVGKLNRLVIPKHQAEKHFPLPLAGDVSVKGTLLNFEDVNGKVWRF
RYSYWNSSQSYVLTKGWSRFVKEKRLCAGDLISFRRSNGQDRQLYIGWESKSGSDQDTGR
VVMRLFGVDISKSLNNAVVKEEETEMLSLRCYKKRRVFDAFVTTV
Download sequence
Identical sequences V4MMZ0
XP_006395630.1.70970 Thhalv10004508m|PACid:20200254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]