SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10004752m|PACid:20199853 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10004752m|PACid:20199853
Domain Number 1 Region: 13-112
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000294
Family B3 DNA binding domain 0.01
Further Details:      
 
Domain Number 2 Region: 176-265
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000706
Family B3 DNA binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10004752m|PACid:20199853
Sequence length 278
Sequence
MPFKSFMDTLLENTSKPSFCKSLTLGESWKSKSMRIIPEEFVTSTPGAFEHRVVFSVRWG
NSWQLWLKRDKKGLFMEEEDWNEFVDDNFLGPHDVLFVTHEDTMNLEVRIYKNYIHLMKE
IISPPVEADPEAELLNPIPQNSHQETPASTSASASASASGARQGCVPVINPEQYLVNPKS
PYFVKTLTKKIDVLYVKQPVIDKYGLKFGPHKSTMYYLIGKEKHEALTKIYCNGRNFCFS
GWAAICRKYKLGEGDTVVCELERSGGVVTAVRVHFVNE
Download sequence
Identical sequences V4ML08
XP_006394800.1.70970 Thhalv10004752m|PACid:20199853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]