SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10005481m|PACid:20199536 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10005481m|PACid:20199536
Domain Number 1 Region: 101-203
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-22
Family B3 DNA binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  Thhalv10005481m|PACid:20199536
Domain Number - Region: 149-312
Classification Level Classification E-value
Superfamily ssDNA viruses 0.00238
Family Parvoviridae-like VP 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10005481m|PACid:20199536
Sequence length 320
Sequence
MMDGAASAAHDVETKASTLMASVDHHHHHHQPGFGSGSGHDHGLSASVPLLGVNWKKRRM
PRQRRSSSSFNLLSFPTMPPSSSHVPTPLPARKIDTRKLRFLFQKELKNSDVSSLRRMIL
PKKAAEAHLPALESKEGIPIRMEDLDGLHVWTFKYRFWPNNNSRMYVLENTGDFVNAHGL
QLGDFIMVYQNFHSNTYVIQARKASEEEEDITNVDEDDVYTDLTRIENTVVNDLFLQDYN
HDHYNNNNNNNEKCSFNYPVIDDITTATTTPSFVYDTTALTSNDTPLDYLGGLTTNNYYS
KFGSFEGFGSVENISLDDFY
Download sequence
Identical sequences V4MMP2
Thhalv10005481m|PACid:20199536 XP_006395520.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]