SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10005733m|PACid:20190281 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10005733m|PACid:20190281
Domain Number 1 Region: 2163-2453
Classification Level Classification E-value
Superfamily BEACH domain 9.42e-121
Family BEACH domain 0.0000000118
Further Details:      
 
Domain Number 2 Region: 2567-2636,2667-2852
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.65e-31
Family WD40-repeat 0.0079
Further Details:      
 
Domain Number 3 Region: 2043-2152
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-22
Family PreBEACH PH-like domain 0.0018
Further Details:      
 
Domain Number 4 Region: 361-398,434-580
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000161
Family Clostridium neurotoxins, the second last domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10005733m|PACid:20190281
Sequence length 2881
Sequence
MEEDEQKKFTKASADGHLDVADKPVIENRIDAFGIDDVDIQGISSVDEVLKDDHFEQVSL
GGDQDKPITESQVDHSVLDTTLGSDHGRSSFGDAQEVPHLLTETLDMHNIEEPMDDLLSN
SEPEREETYHISATSVDSFYPLVQSPQKPKPKATMPNVSPELLHLVDSAIMGKPESLEKL
KNIVTGIEIFGSGEDPETTAFLVIDSLLATMGGVESFEEDEDSNPPSVMLNSRAAIVSGE
LIPNLPCSGDSVTSMSPRTRMVRGLLAILRSCTRNRAMCSTAGLLCVLLRSIEEILSKEA
NMVWDATVLFHCIEHLAGHSLSVEDLHRWLQVITKSLPTVWSSPLMDALEKAMNGKESRG
PACSFEFVGESSGLLGPGESRWPFTNGYAFATWIYIESFTDTLNASTAAAAIAAASAAKS
GKTSANVHAGEDTAHMPRLFSFMTTDNHGIEAFFYAQFLVVECSNGKGSKASLHFTHAFK
PQCWYFIGLEHTCNQGLLGNSESELRLYVDGSLYETRPFEFPRISKPISFCCIGSNPPPA
ATGLQHRRRQCALFAEMGPVYIFKEPIGLERMTRLASRGGDVLPCFGNGAGLPWLATNDH
VRNGAEESSLLDAELGVYIHLLYHPCLLSGRFCPDASFSGATGTLRRPAEVIGQVHVATR
IKSVESFWALAHGGPMSLLPLTVSSVHKDSLEPSSRNLPLSLTTYSLAAPIFRMISVAIQ
HPGNNEELSRIRGPEILATILSYLVNSLASPDLKHDGVEDEELVAAIFSVCQSQKINHSL
KVQLFRTLLLDLKIWSVCSYRLQKKLLSSLQDMVFTEATAMRNADAIQILLDGCRRCYWM
IQEKDSVHTFSLDGNARQMGEINALVDELLVIIELLMGAASPSFAADDVHRLLGFIIDSP
QPNQVVRVLHLMFRLVVQPNAAKAQTFAEAFITTGGIETLLVLLQREAKKGDENVAESVA
KAETIETRLLKHLDSALQDNEGDPDAHDDNVVSLKETEPVQDVDRTSSVCETLFINNAIN
TARNNVDDRDRVMVGIIRLIGALISKGHLKVSLGAESDVMSNLMSSGLHENGGTMFDDKV
ALLLFALLKAFQAAPNRLMTDNVYITLLGASINASSSEDGLNFYDSGHRFEHPQLLLILL
RSLPFASKTLQNRALQDLLFLACSHPENRSNLTKMEEWPEWILEILISNYERDARKQSAE
VEDLIHNFLIIMLEHSMRQKDGWKDIEATIHCAEWLSIVGGSSTGEKRIRREESLPVFKR
RLLGGLLDFAARELQAQTQVIAAASAGLAAESLAPEDAKAGVENAAQLSVFLVENTIVIL
MLVEDHLRLQSKQNCAASAIDVSPSPLSLVYPTNNRSRTLATVGESSEVSSSRASVSSDS
GGVHLDILASMADASGQISTAVMERLAAAAAAEPYESVSCAFVSYGSCTMDLAEGWKYRS
RLWYGVGLPSNTTCFGGGGSGWDSWKSVLQKDAEGKWIELHLVKKSVSMLQALLLDESGL
GGGLGIGGGSGTGMGGMAALYQLLDSDQPFLCMLRMVLLSLREEDHGEDSLLMKNLSSED
GFSGGLQCSLGNPVSLDVSSQMSMRQSPSALLWSVLSPILNMPISDSKRQRVLVTTCVLY
SEVWHAVSRDKRPLRKQYLEAILPPFVAILRRWRPLLAGIHELATGDGLNPLVVDDRALA
ADTLPIEAALSMISPEWAAAFASPPSAMALAMIAAGAAGWEAPTPPAPPPPLKRDTSLLE
RKTTKLQTFSSFQKPLEAPNDDTPGRPRDKATAKAAALAAARDLERNAKIGSGRGLSAVA
MATSAQRRNITDMERLQRWNISEAMGVAWMECLQPVDTKSVYGKDFNALSYKFIAVLVAS
FALARNMQRSEIDRRIRDDNIVRNRLCMGIRGWRKLIRYLVEIRCFFGPFGDHLSSPKHV
FWKLDSTESSSRMRPCLRRNYSGTDHVEAAGKYDDQDNLGSPSKAPLLAAEALSKEIIMY
EDDEHGDDDDLETEGNVGEHKGKNVERMSGSLEDAIQFSTGISDPRPLSDQDVVQNSTQV
LDERVVLEVSSSMVRPLKIVKGTFQITTRRINFIVDSREGQHVDGKSDGSETGDQERDRS
WLMSSLHQIYSRRYLLRKSALDIFMVDRSNYFFDFGNTEGRRDAYRTIVQARPPHLNNIY
LATQRPEQLLRRSQLMERWARWEISNFEYLMQLNTLAGRSYNDITQYPVFPWILSDYVSE
VLDVSNPSNYRDLSKPIGALNPERLKKFQEKYSNFEDPIIPKFHYGSHYSSVGAVLHYLA
RVEPFTTLSIQLQGGKFDRANHMFSDIAATWKEVLHDMSNVKELVPELFYLPEVLTNENL
INFGATQLGEKLDSVKLPPWAKSPIDFVHKQRMALESEHVSAHLHEWIDLIFGYKQRGEE
AILANNVFFYTTYEGTVDIDKITDPVRQRATQDQIAYFGQTPSQLLTVPHIKRLPLKDVL
HMQTIFRNPKAIKPYPVQAPEHCNLPAAAIKASSDSVVIVDMNVPAAHIAHHKWQPNTPD
GHNAPFIFHHGKAASSGGTLIRMFKGDWEYPQAQAFASSGITSSSVTAITSDGEIITGGH
VDNSIKLVSSDGAKTLETAFGHCAPVTCLALSPDSNFLVTGSRDTTVLLWRFHKGFTSQA
SESEQTKSSETLSSASNTLANKRRRIEGPIQVLHGHLREIVCCCVSSDQGIVVSSSESSD
VLLHSIRKGRLIRRLVGVKAHALCISCDGVVVVWSRSENSISTFTINGILISKAKLPSSC
TISCMELSMDGQSVVIGVNSFSGIDEEDSSSGGKAIERLDIPSPSICFLNLHTLKVFHVM
KLGEGQDITSMALNTDNTNLLVSTVDKQLIIFTNPHLSSKVVDQTLKLVGSERKLDSTNR
N
Download sequence
Identical sequences V4NDB7
XP_006402528.1.70970 Thhalv10005733m|PACid:20190281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]