SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10005857m|PACid:20190472 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10005857m|PACid:20190472
Domain Number 1 Region: 111-252
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.88e-39
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 476-556
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000183
Family PB1 domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10005857m|PACid:20190472
Sequence length 584
Sequence
MANVDGDDFRNSSPRSYQDQLYTELWKACAGPLVEVPLAEERVFYFPQGHMEQLVASTNQ
GIESEEIPDFNLPPKILCRVLSVMLKAEHETDEVYAQITLQPEVDQSEPTPLVEPTKQMF
HSFVKILTASDTSTHGGFSVLRKHATECLPALDMTQATPTQDLVTRDLHGVEWRFKHIFR
GQPRRHLLTTGWSTFVSSKRLVAGDAFVFLRGENGDLRVGVRRLARHQSTMPTSVISSQS
MHLGVLATASHAVRTQTLFVVFYKPRISQFIVGVNKYMEAMKHGFSLGTRFRMRFEGEES
PERIFTGTIVGTGDLSSQWPASKWRSLQVQWDEPTTVQRPDKVSPWEIEPFLPTSPVSTP
AQPKCKRSRPIESSVLTPAPANLLYSFPQSQDPTNASLKLFQDPSTERNPGGFAINNSFK
ADTPTPASCCYRLFGFDLASSPPALIPPEKQSLDTSAVAKCQEPITPNASNEQKKQQTSR
TRTKVQMQGIAVGRAVDLTLLKSYDELIKELEEMFEIQGQLLSRDKWIVVFTDDEGDMML
AGDDPWNEFCKMAKKIFIYSSDEVKKMTTKMKISSSLEDEESMD
Download sequence
Identical sequences V4L0T8
XP_006402437.1.70970 Thhalv10005857m|PACid:20190472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]