SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10006534m|PACid:20186567 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10006534m|PACid:20186567
Domain Number 1 Region: 219-437
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000262
Family Tropomyosin 0.0056
Further Details:      
 
Domain Number 2 Region: 429-608
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000948
Family Tropomyosin 0.0017
Further Details:      
 
Weak hits

Sequence:  Thhalv10006534m|PACid:20186567
Domain Number - Region: 678-773
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00262
Family Myosin rod fragments 0.0042
Further Details:      
 
Domain Number - Region: 815-888
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00628
Family Intermediate filament protein, coiled coil region 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10006534m|PACid:20186567
Sequence length 1818
Sequence
MSAVANGNTKRYSWWWDSHISPKNSKWLQENLTDMDSKVKQMIKVIEEDADSFARRAEMY
YKKRPELMKLVEEFYRAYRALAERYDHATGVIRHAQQTMAEAFPNQDPMMFGEESLVGSS
TNEFDPQTPESYPPIRAPVYPNELKKDALGISFPHMSTVKRNIAFMEEPHQPASNGKGLK
TGKARKGLNFNDVDGNGRNAKVLSESERASRAEAEIVVLKDALSKVQAEKEANLAQFDQN
LERLSNLESEVSRAQEDSRGFNERATRAEAEVETLRETLSKLENEKESSLLQYQQCLQNI
ADLEGRISLAQEEAGEVNERASQAKAEILALKQSLVISETDKEAALVQYRQCLETISSLE
ERLHKAEEDARLINQRAEDSEGEVEILKQKVSKLIDENEAYVLQYQQCLDTIADLKLKLF
HAQEETQRLSREIEDGVAKLKFAEEKCVVLERSNQNLHTELDGLLEKLGNQSHELTEKQK
EMGRLWTSVQEEHLRFMEAETAFQTLQQFHSQSQEELSTLALELQNRSQILKDMEARNND
LQEEVQEAKDENKSLSELNLSSAASIKSLQEEVSRLRETIQKLEAEVELRVDQRNALQQE
IYCLKEELFQIGKKHQSMVEQVELVGLHPEGFGSSVKELQEENSTLKEIKERESVEKMAL
VEKLEMMEKLVQKNLLLENSISDLNSELETIRGKLKTLEEACVSLAEEKSGLHSEKDVLI
SRLQSATEYSKKLSEENRLLENSLSDANAELEELKSKLKSLEDSCYLLNDDKSSLVNERE
SLLSHMDIMRKSIEDLEKEHAELKVKVLELATERESSLQKIEELGVSLDAKDREYACFVK
MSGSRINDMESKIYHLQDEIQRQESEYQVELDRVHDAHIEIIVLQKCLQDWLEKSSSLAA
ENQNIKEASQLLEKLVSELEQQNIGKQLQIESSINCIKILRTGIYQVLMKLEVIPGIDSG
DENSQDQQNIHDILSRLDEMQTSLLKTRNENQQSVIENLVLVEFLRQLKSEAVSIATEKK
ALEEELKSQRNQLLFSRDETQKFIIINGELTTKVNQGADREEALTGKIEDLHRQSSIENL
VLVEFLRQLKSEVVGIATEKKILEEELESQCYQLSFSRDETQRLIYVNGELTTKVNQGVN
REEVLKVEIEDLHRQVLQLRNDYTILQAEKNKTLDEKKYLTKSTLRLEEEKRKLEEDMSL
LLSETIYQSNLILLLEDVVLEKLSGAVKLNEDLDRLIFVKCKLEEEVREVGDKLKATEVE
NLQLEALLEKTDGELHTARSANDQLEHEIANVKDQLGQKEKELLEAMLMISIVQSEKSEL
SKAVEDLDCRYKETKSIEVDKDKQVLKLRGDYDEQIKKTGHANEANLKLEANMMSLLMEL
EGIKVEKEKLNQELLTERNEIKLWESQATTLFGDLQISAVHETLLEALTHELAESCESLG
NRSTLKDLEIDQLKGRVNNLEDANKGQNDLMSKYAQAIVLLKESIESLEKHIAMPHEFES
EPAKDTASIVDNNDWFLELQEMRFRIKAIEEALTEKLAMEELKTAARRSRRRSGSLRKQN
HGIYSEESEMITKDIVLDQVSDCSSYGISKRDILKIEDDHSFELKPQNPQKGKSLSEESL
VVDKLEISDRFTDPNKETNKRKVLERLHSDLQKLSNLHIAVEDLKSKVETEGESEKGKED
EYETIKGQITEAEEALEKLLSINRKLVTKVQSGFERSDGSKSSMDLDENESSRRRRISEQ
ARRGSEKIGRLQLEIQRLQFLLLKLEGERDDRAKAKISDSKARILLRDYIYGGVRGERRK
RMKKRFAFCGCVQPPPSP
Download sequence
Identical sequences V4KFT0
XP_006418267.1.70970 Thhalv10006534m|PACid:20186567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]