SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10006748m|PACid:20187001 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10006748m|PACid:20187001
Domain Number 1 Region: 145-284
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.29e-45
Family B3 DNA binding domain 0.0044
Further Details:      
 
Domain Number 2 Region: 806-871
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000549
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10006748m|PACid:20187001
Sequence length 901
Sequence
MMASMACVEDKMKTNGLVSGGTTTTSQSTLLEEMKLLKDQSGTRKPVINSELWHACAGPL
VCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNYPNLPSQLMCQVHNVTLHADKDSDE
IYAQMSLQPVHSERDVFPVPDFGLLRGSKHPTEFFCKTLTASDTSTHGGFSVPRRAAEKL
FPPLDYTAQPPTQELVVRDLHENTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLRAGDSVL
FIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIGVLAAAAHATANRTPFLIFYNPRAC
PAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSGKRRYMGTIVGISDLDPLRWPGSKW
RNLQVEWDEPGCNDKPTRVSPWDIETPESLFIFPSLTSGLKRQLHPSYFAGETEWGSLIK
RPLIRVSDSANGILPYASFPNMASEQLMKMMMRPHNNQNATSFMSEMQQNVLMGHGGLLG
DMKMQQPMVRNQKSEMVQPESKLTVNPSASNISGQEQNLSQSMNAPAEPEKSTLSGCSSG
RVNHGSEQQSMEQASQVKTVTVSNEEKVNQLIQKPSALSPPQADSCPDITQQMYPPLSDP
NPINGFSFLETDELTSQVSTFQSLSGSYKQPPMLSSQDSSAVVLPDSTNSSLFHDLWDTQ
LNGLKFDQFSPLMQQDLYACQNMCMSNSTHSNILDPPLSNTVLDDFCAIKETDFQNQPSD
CLVGNNNSSFAQDVQSQITSASFADSQAFSRQDFPDNSGGTGTSSSNVDFDDTSLLQNSK
GSWQKLATPRVRTYTKVQKTGSVGRSIDVTSFRDYEELKSAIECMFGLEGLLTQPQSSGW
KLVYVDYESDVLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNSAGINDLKTSV
S
Download sequence
Identical sequences E4MXL0 V4MSL0
XP_006416458.1.70970 Thhalv10006748m|PACid:20187001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]