SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10009082m|PACid:20186232 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10009082m|PACid:20186232
Domain Number 1 Region: 7-100
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-22
Family B3 DNA binding domain 0.00000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10009082m|PACid:20186232
Sequence length 135
Sequence
MAATNEESFIKPFISEKSSESLEIPLGFNEYFPHPLPNTVELLDYCGRSWTIRMKRIGDK
VFLTVGWENFVKENNLEDGKMMNFIYDCNRTFHVIIFGHHGVSEFIDFPQVVMDVDEYET
CEEEEEEEDDNNISN
Download sequence
Identical sequences V4KUZ6
XP_006416796.1.70970 Thhalv10009082m|PACid:20186232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]