SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10009500m|PACid:20186111 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10009500m|PACid:20186111
Domain Number 1 Region: 9-111
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-20
Family B3 DNA binding domain 0.0031
Further Details:      
 
Domain Number 2 Region: 263-349
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.82e-16
Family B3 DNA binding domain 0.026
Further Details:      
 
Domain Number 3 Region: 151-251
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000179
Family B3 DNA binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10009500m|PACid:20186111
Sequence length 351
Sequence
MAGQSLHSPTKPHFFQPLLPGFHSHLNMPVSFFSKHVEGRHNQNKTAKLRSDASEKTWSV
KMDGLKFTDGWEDFAVAHDLRIGDIIIFRHEGDMVFHVTALGPSCCEIQYTSSTSNETDG
NGDDQTNHIGNRTRVKRKRVKKNRRKKAESSSSDHSHFEAKVSASSLEMDRLYLPRIFAR
SNGLDKMSGEKILLLNEEGRSWNLNLKYNEAGMHTFIRPGWRRFCAQNGMKQGHYTFKLV
QKSGPPVIRLCRALHRAKTDQESSLHHSCYYLPQGFTRLNGINKPGKITLLGEDGVKKVV
DLLQNKRTGTMRIGKGWREFCDAHGVKIGESFVLELIWEEKASPVLKFCTK
Download sequence
Identical sequences V4K9F8
Thhalv10009500m|PACid:20186111 XP_006415947.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]