SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10010085m|PACid:20207143 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10010085m|PACid:20207143
Domain Number 1 Region: 105-402,429-444
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.18e-78
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000131
Further Details:      
 
Domain Number 2 Region: 508-594
Classification Level Classification E-value
Superfamily DUSP-like 0.000000000641
Family DUSP, domain in ubiquitin-specific proteases 0.0093
Further Details:      
 
Domain Number 3 Region: 965-1029
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000122
Family Ubiquitin-related 0.016
Further Details:      
 
Weak hits

Sequence:  Thhalv10010085m|PACid:20207143
Domain Number - Region: 764-855
Classification Level Classification E-value
Superfamily DUSP-like 0.000314
Family DUSP, domain in ubiquitin-specific proteases 0.0079
Further Details:      
 
Domain Number - Region: 635-700
Classification Level Classification E-value
Superfamily DUSP-like 0.000811
Family DUSP, domain in ubiquitin-specific proteases 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10010085m|PACid:20207143
Sequence length 1071
Sequence
MSRPNTRNKNKRQRPSEAVDSSSQILRKIHEANDVTDEDINQLFMIWKPVCQGCRVNTRD
NPNCFCGLVPPVNGSRKSGLWQKTSEIIQSLGPDLSLDSRASDSTPAGLTNLGATCYANS
ILQCLYMNTAFREGVFSVEVDVLKQYPVLDQIARLFAQLHASKKSFVDSDAFVKTLELDN
GVQQDTHEFLTLLLSLLERCLRHSGVCKAKTIVQDLFRGSVSHVTTCSKCGRDSEASSKV
EDFYALELNIKGLKTLDDSLNDYLSLEQLNGDNQYFCGSCDARVDATRCIKLRTLPPVIT
FQLKRCVFLPKTTAKKKITSSFSFPQVLNMGSRLAESSQNELTYDLSAVLIHKGSAVNSG
HYVAHIKDEKTGLWWKFDDEEVSELGKHPFNEGSSSTPQSESNGTVSSGKTTDVIQSSSS
DCTSAIKSEVFSSSDAYMLMYSLRCSKKESQEGQRENPIDITKGEVDSVQQPEGGCLPLH
LHEWMNNMNASFLENCKQYDLRKERELNALTERRQEVRTILSEAAVHSLEEQYFWVSTDW
LRLWADTILPPALDNTPILCSHGKVLASKVNCMKRISELAWTKLESKFNGGPKLGKGDYC
RECLMDGARMVVSSDSYRDRRTFMKSIASDVLSGKCEDGMYYVSRVWLQQWIKRKNLDAP
SEADAGPTIAITCNHGELMPEQAPGAKRILVPENLWLFLAEDSLKVTPEDTSGCHCFPLD
SSQCSHCTEELSEVACLEDSLRTIKVKQRQNHEKLATGKGIALTPQSRYFLLPSPWLVQW
RSYINMTGKNSSSAPEPELLDGVIDTLKCKKHARLLERLPELVCRRGLFYQKNPSTDKLT
LIPEHDWKFFCEEWGGIMENGVSALIEVNNKTDQSSSQDVIDLESSPDDTMDIDTQQLIL
RTTPEICEECIGERESCELMQKLSYSEGDVFVCLVRGKEAPKAMLEVSDSSFEVDRRTSK
RSRRTNYGKLTSLKVSATTTVYQLKMMIWELLGVMKENQELHKGTKMIDEESATLADMNI
FPGDKLWVRDTEMHEHRDIADEICDKKTGPQDIEEGFRGTLLTGDISSEAY
Download sequence
Identical sequences V4M082
Thhalv10010085m|PACid:20207143 XP_006404125.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]