SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10012062m|PACid:20185054 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10012062m|PACid:20185054
Domain Number 1 Region: 120-221
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.26e-22
Family B3 DNA binding domain 0.0057
Further Details:      
 
Weak hits

Sequence:  Thhalv10012062m|PACid:20185054
Domain Number - Region: 17-60
Classification Level Classification E-value
Superfamily Rotavirus NSP2 fragment, C-terminal domain 0.0523
Family Rotavirus NSP2 fragment, C-terminal domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10012062m|PACid:20185054
Sequence length 224
Sequence
MDSAHNQLNKRARLFGDLENKDAKVIYPPIPASTAPLNKGSDGSTATQSLFAESKPEETP
KVLKKRGRKKKNPNPEEMNSSTPGGDDSENRSKFYESASARKRTVTAEERERAINAAKTF
EPTNPFFRVVLRPSYLYRGCIMYLPSGFAEKYLSGISGFIKLQLGEKQWPVRCLYKAGRA
KFSQGWYEFTLENNIGEGDVCVFELLKTRDFVLKVTAFRVNQYV
Download sequence
Identical sequences V4KH98
XP_006393253.1.70970 Thhalv10012062m|PACid:20185054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]