SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10012074m|PACid:20185111 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10012074m|PACid:20185111
Domain Number 1 Region: 5-112
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-33
Family B3 DNA binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 447-524
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000491
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10012074m|PACid:20185111
Sequence length 568
Sequence
SSVKRTPHMFCKTLTASDTSTHRGFSVPRRAAEDCFAPLLYLDHLIAKDLHGVEWKFRHI
YRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFLRDEDGELRLGIRRSARPRNGLPDSIIEK
NSCSNILSLVANAVSTKSMFHVFYSPRFRMRFEMEDSPERRCAGVVTGVCDLEPYRWPNT
KWRCLLVRWDESFVSDHQERVSPWEIDPSGSLPQLSIQSSPRPKRPWAGLLDTTPPGNPI
TERGGFLDFEESVRPSKVLQGQENIGSASPLQGFDVMNRRILDFAMQSHANPILLSSRVK
DRFGEFVDATSLDPACSGVMNLDRFPRVLQGQEICSLRSFPQIAGFSPAATSGKPNLGYT
DPFAYNQANKSKKSSVYPINFGGETRKFLAQKEGGLPKNVTADFPFKIDMMGKQKGGDFD
MNASSECKLFGFSLPVETPAANPQSSSKRICTKVHKQESLVGIAIDLSRLNGYNDLLTEL
ERLFNMEGLLRDPEKGWRILYTDSENDMMVVADDPWHDFCNVVLKIHLYTKEEVENGNND
NKSCLEQVAVLMEASVSQPDSSPTVTRV
Download sequence
Identical sequences V4KI31
Thhalv10012074m|PACid:20185111 XP_006393583.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]