SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10012233m|PACid:20184972 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10012233m|PACid:20184972
Domain Number 1 Region: 192-311
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000255
Family B3 DNA binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10012233m|PACid:20184972
Sequence length 320
Sequence
MKKDDYYREFSSQSNKYWKLDILADVAAEEYSTMTSEEDKSKSSSSSSTGVKPDYNLRDG
SNSKLEILVKVASDMLEHETPKKKRSQKSTACVDYKQEEEDRSFKKRKIIGRCKVGSSST
STKEKQVLENLDWDPESLPSSCITECSKKKCPPTNISCKKLKIVRSLDFGPTQTMNPPGW
LLNVMREYNGHDPKLIITKPLFQSDLDKGKNRLQMPINQLVNTNFLTDEETRIIHKKYLS
STRKTRKTTGLSVVLVDPLSKRHVVDFRKWKMNGIWVYVFNTRWWNVVTANKFKVGDIYH
VWSFRSGQGKLCFALVPKNS
Download sequence
Identical sequences V4MG52
XP_006393025.1.70970 Thhalv10012233m|PACid:20184972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]