SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10012253m|PACid:20184169 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10012253m|PACid:20184169
Domain Number 1 Region: 3-96
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000182
Family B3 DNA binding domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10012253m|PACid:20184169
Sequence length 102
Sequence
MDPNMLIVKKITNTDVSCKNGLSLSKPKMDYILRKMGISVPENGLQVEIQDNDKSYWVTL
KQNSNGYHVGTGWSNIKNAKDLEKDDVVQLYWKDTKFIFSME
Download sequence
Identical sequences V4KTT3
XP_006393487.1.70970 Thhalv10012253m|PACid:20184169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]