SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10012266m|PACid:20184241 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10012266m|PACid:20184241
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.66e-16
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10012266m|PACid:20184241
Sequence length 137
Sequence
MIPNTYAVKHLPYISIDQNDREEGEIAEDVEEVVVYDKAMTQWKFKYCYLRSSQSFVFTR
GWNGFVKEKNLKENDVILFYECDDVKTLQGQSKILMIDVQYSSDNGFVDSKGVNNKVDES
SDEERKTGNDFDPQVRR
Download sequence
Identical sequences V4KGS2
Thhalv10012266m|PACid:20184241 XP_006393118.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]