SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10012356m|PACid:20184298 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10012356m|PACid:20184298
Domain Number 1 Region: 180-280
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.88e-27
Family B3 DNA binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 49-108
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000000262
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10012356m|PACid:20184298
Sequence length 360
Sequence
MDIDQTGTETKTMETTSGSSDSVLRLTQSLKPTESTSTNFALSNTATTKYKGVVQQQNGH
WGAQIYANHKRIWLGTFKSAAEAAAAYDSASIKLRSFDANSHRNFPWSDLTVHEPDFQVR
HTTEAVLNMIRDGSYQHKFRDYLRVKSQFVANINIVGSKQSRGGGGEGGQESNKCFTWML
LFQKQLTPSDVGKLNRLVIPKKYAVKHLPFISDDQNEREEGEVGGSVDDVEVVFYDKAMR
QWKFRYCYWRSSQSFVFTRGWNGFVKEKNLKENDVIVFYNCDVPSNVKTLEGQSNNFLMI
DVQYFSGNGFVDPKGLNKTAHEISDEEMKTGNVFDPKLEDKGTKSEEKKGGFMLFGVMIQ
Download sequence
Identical sequences V4KGP0
XP_006393078.1.70970 Thhalv10012356m|PACid:20184298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]