SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10012513m|PACid:20203957 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10012513m|PACid:20203957
Domain Number 1 Region: 60-199
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-42
Family B3 DNA binding domain 0.0046
Further Details:      
 
Domain Number 2 Region: 974-1039
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000932
Family PB1 domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10012513m|PACid:20203957
Sequence length 1088
Sequence
MQKQTDFIPSYPNLPSKLICMLHNVTLNADPETDEVYAQMTLQPVNKYDRDALLASDMGL
KLNRQPNEFFCKTLTASDTSTHGGFSVPRRAAEKIFPALDFSMQPPCQELVAKDIHDNTW
TFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDGKAQLLLGIRRANRQQPALSS
SVISSDSMHIGVLAAAAHANANNSPFTIFYNPRAAPSEFVVPLAKYTKAMYAQVSLGMRF
RMIFETEECGVRRYMGTVTGISDLDPVRWKNSQWRNLQIGWDESAAGDRPSRVSVWDIEP
VLTPFYICPPPFFRPRFAGQPGMPDDETDMESALKRAMPWLDNSLEMKDPSSTIFPGLSL
VQWMNMQQQNGQLPSAAAQSGFFPSQTAALHNSLGGTDDPSKLLSFQTPPGGISSSNLQF
NKPNPQAPMSQLPQPSTTLSQQQQLQQLLHASLNHQQQQSLSQQQQQQQSLQQQHQQPLQ
QQSQQLQQSQQLRTQPSQSHSHPQPQPQPQHLQPHKLQQFQLPQNQLYNGQQAAQQFKEQ
QASMHHLLPQVVSESMASSVIAPSSSSHNQSFQQQQQSTQLHHTHRHLGASTSQSSVIET
SKSSSNLMSIPPQDTQFPRQVEQQQPPGLVKGHNQQTLLQQKTQQAQAHAQVQQLFQQNL
LEQPHLQFQLLQRLQQQQQQQQQQQHQQFLSPGSSSMQSQLLHQQLPQLPSLSQGQQFPS
SCINNGLSTLQPPQMVVSRPQDKQNPPVGGGVKAYSGITDGGDAPSSSTSPSTNNCQISS
SSFLNRSQSGPAILIPDTPVDMSGSLVQELYNKSDMRQKQELVGQQKAKASLTDHQLEAS
ASGTSYGLDGGDNNRQQNFLAPTFGLDGDSRNSLLGGATVDNGFVPDTLLSRGYDSQKDL
QNMLSNYGGVTNDIGTEMSTSAVRTQSFGIPNVPAFSNDVAVNDAAVLGGGLWPTQTQRM
RTYTKVQKRGSVGRSIDVNRYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYVDHENDI
LLVGDDPWEEFVNCVQSIKILSSAEVQQMSLDGNFTGVPVTNQACSGGDSGNAWRGHYDD
NSATSFNR
Download sequence
Identical sequences V4N8R7
XP_006400643.1.70970 Thhalv10012513m|PACid:20203957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]