SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10014488m|PACid:20206065 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10014488m|PACid:20206065
Domain Number 1 Region: 10-104
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.14e-17
Family B3 DNA binding domain 0.00059
Further Details:      
 
Domain Number 2 Region: 145-242
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000804
Family B3 DNA binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10014488m|PACid:20206065
Sequence length 250
Sequence
MNQGHNADYCLPKFFKVYLAGISGDDMEVPVSFNRCLPKCLPNNVTIKSIYGKIWKMALR
KCGEKYVLVNGWKMIVKDEDLVGGDVLEFDFDGSQCFNFCIYEPRTMCKRLRRSSVRGEE
ETRANDDNDATLEDVDVSDQRQYLDDPNNPFFPVTLNPNRRSQLRIPRKVITDYGLNFPE
NITLVDTLVKKFGKLAKKIKIQLNGSVFVKGYGAILRRNNVKSRDKLICELKKTGSNNMV
HTIKFHVISE
Download sequence
Identical sequences V4N989
Thhalv10014488m|PACid:20206065 XP_006400878.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]