SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10015675m|PACid:20205196 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10015675m|PACid:20205196
Domain Number 1 Region: 40-161
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.92e-30
Family B3 DNA binding domain 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10015675m|PACid:20205196
Sequence length 305
Sequence
MSVNHYSTDHHHHNTLLWQDRHATDTSEATTATWLNDDQQKESLFEKSLTPSDVGKLNRL
VIPKQHAEKYFPLNAVIVSSSGGADTSSSTSTEKGMLLSFEDESGKCWRFRYSYWNSSQS
YVLTKGWSRFVKDKQLDPGDVVFFQRQRSDSRRLFIGWRRRGQGSSTNSAVNTTSYASSM
AAPPYLQIHASSNNYPNPPPHSEYSHYGAAVVTAAETHSIPSSSAVVGSSRTVRLFGVNL
ECQMDEDDDGDDSVTAAECPADGYYGQYMHYYYTPHPHSMMKWETDEIIIETKVGPTKMM
VYRIG
Download sequence
Identical sequences V4KRK1
Thhalv10015675m|PACid:20205196 XP_006399092.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]