SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10016149m|PACid:20179844 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10016149m|PACid:20179844
Domain Number 1 Region: 491-760
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000000000379
Family Tropomyosin 0.00023
Further Details:      
 
Domain Number 2 Region: 709-992
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000817
Family Tropomyosin 0.00094
Further Details:      
 
Weak hits

Sequence:  Thhalv10016149m|PACid:20179844
Domain Number - Region: 1018-1261
Classification Level Classification E-value
Superfamily Tropomyosin 0.00327
Family Tropomyosin 0.0015
Further Details:      
 
Domain Number - Region: 90-342
Classification Level Classification E-value
Superfamily Tropomyosin 0.0137
Family Tropomyosin 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10016149m|PACid:20179844
Sequence length 1338
Sequence
MEETTQVASSQVPVVKPGDDDLKTVDVAVKTVNGEVTKDRKEEEDTTLDGEFIKVEKETF
DAKDDAKKAEHVPVEEQKQVSIERSSSGSQRELHESQEKAKELELELERVAGELKRYESE
NTHLKDELLSAKEKLEETEKKHGELEVAQKKQQEKIVEVEERHSSQLKSLEDALQSHDAK
DKELTEVKEAFDALGIELENSRKKLIELEEGLKRSAEEAQKFEELHKQSASHADSETQRA
LEFAQLLESTKDSAKKMEEKMASLEQEIKELNDKISENEKVEAALKSSAGELAAVQEELA
LSKSRLLETEQKVSSTEALIDELTQELEKKKASESRFKEELSVLEDLVVQTKDLQAKLSE
QEGINSKLGEELKEKELLESLSKDQEEKLRTANEKLSEVLKEKEALEADVAEVTSNAAKV
KAICSELEEKLKTSDDNFTKADALLSQALSNNSELEQKLKSLEELHSESGSVAAAATKKN
LELEEVVRSSSQAAEDAKSQIKELETKFSAAEQKNVELEQQLNVLQLKNSDAEQELKELS
EKVSELKVAIEVAEEEKKQVTTQMQEYQEKASELESSLKLSSAKTSELEEDLRIALQKGA
EHEERANTTHQRSIELEGLCQTSQSKHEDAEGRLKDLELLLQTEKYRIQELEEQVSLLEK
KSGDTEADSKGYLGQVAELQSTLEAFQVKSSSLEAALNAANDNERELTENLNAVMGEKKK
LEDTVNEYSAKISESENLLESLRNELGVTQGKLESIENDLKAAGLRESEVMEKLKSAEES
LEKKGKEIDEAMKKSMELEALHQSSSKDSEHKIQMVMEDFTRRDSDANSLTEKLKDLEDR
IKSYEEQLAEASGKSSSVKEELDQTLGKLAAAEAVNDKLKQEFDQAHEKSLQSSSENELL
AETNNQLKIKIQELEELLGSSSAEKETAMKQVEEATERLNQKETEFKDFIEKLKAHENQI
EEHKRQAHEASGVADTRKVELEEALSKLKNLESTIEELGAKCHGLEKESGDLAEVNLKLN
QELANHGSEANELQTKLSALEAEKEQTTKDLLASKTAIEDLRKQLTSEGEKMQSQISSLT
EENNQVNAMFQSTKGELQSAISKLEDQLNVERSKADTLVSEIEKLGAVAAEKSVLESHVE
ELEKKLSKVEAQLKEEGENAAAASEKVAELNSKLQEHENNASDRDVLNEQVLQLQKELQA
AHSSIAEQEQAHSQKHSELESALKQSQEEIEAKKKAVSEFESMVKDLEQKVQLADAKAKE
TEAMEVGVKSRDIDLSFSSPTKRKSKKKSDTSPSSSSSPGNAVTTTQTASTSHLMSVKII
SGVALISVIIGIILGKKY
Download sequence
Identical sequences V4MGW0
Thhalv10016148m|PACid:20179843 Thhalv10016149m|PACid:20179844 XP_006410354.1.70970 XP_006410355.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]