SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10016263m|PACid:20180001 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10016263m|PACid:20180001
Domain Number 1 Region: 302-400
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-18
Family B3 DNA binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10016263m|PACid:20180001
Sequence length 809
Sequence
MFEVKMGSKMCMNASCGSTSTVEWKKGWPLRSGALADLCYRCGSAYESSLFCETFHMDQS
GWRECYLCSKRLHCGCIASKLMVELMDYGGVGCTTCASCHQLNLNKRSENPGLFSRLPLK
TLAERQHINGESGMSIDGGRNEADLFSQSQRCDSQPLVPGVDKREDFMPPHRGFGILKSE
NSTGYRLDAGEMHESSPLQPSLNMALAVHPYSPSFASTPVEGKKHIGPSQSHIVQCSASS
ILQKPSKSVLGTPPGTSKSAQARIGRPPVEGRGKGHLLPRYWPKYTDKEVQQISGNLNLN
IVPLFEKTLSASDAGRIGRLVLPKACAEAYFPPISQSEGIPLKIQDVRGKEWTFQFRFWP
NNNSRMYVLEGVTPCIQSMMLLAGDTVTFSRVDPGGKLIMGSRKAAHNTGDMQGYGLTNG
TSNEDTSSSGVTENPSSINASSCPSQIPEELKGLPENLNGGSCSKKSEINGGTMCDDPPR
PKDKKRTRTIGAKNKRLLLHSEESMELRLTWEEAQDLLRPAPSAKPTIVVIEEHEFEEFD
EPPVFGKRTIITSRPSGEQERWASCDDCSKWRRLPVDALLSVKWTCSDNVWDVSRCSCSA
PEESLKELENVLRAGKDCKKRRIGVSQTAKTGQEPSGLDALASAAVLGDALGEPEVATTT
RHPRHRVGCSCIVCIQPPSGKGRHKPNCGCNVCSTVRRRFKTLMMRRKKKQLERDGPAAA
AAEDQENAEAKQGDSDKSKAEEEVKTGRIDLNSDPYNREDIEAVAVEKEGSEGREVGQCS
GVAQGGDVLGVTELVGEAEKISEEPKGSS
Download sequence
Identical sequences V4NXH2
XP_006410148.1.70970 Thhalv10016263m|PACid:20180001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]