SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10016329m|PACid:20180956 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10016329m|PACid:20180956
Domain Number 1 Region: 110-216
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.79e-29
Family B3 DNA binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10016329m|PACid:20180956
Sequence length 702
Sequence
MEQEKSLDPQLWHACAGSMVQIPSVNSTVFYFAQGHTEHAHAPPDFHAPRVPPLILCRVV
AVKFLADAETDEVFSKITLLPLPGNDLDLENDAVLGLTPSPDGNGPNGNEKPASFAKTLT
QSDANNGGGFSVPRYCAETIFPRLDYTAEPPVQTVIAKDIHGETWKFRHIYRGTPRRHLL
TTGWSTFVNQKKLIAGDSIVFLRSESGDLCVGIRRAKRGGLGSNGVGSDNNNIPYPGFSG
FLRDDETTTSKLMMMKRSGGNGNDANAAAGGGRVRVEAVAEAVARAARGQAFEVVYYPRA
STPEFCVKASDVRSAMRIRWCSGMRFKMAFETEDSSRISWFMGTVSAVQVADPIRWPNSP
WRLLQVAWDEPDLLQNVKRVSPWLVELVSNMPTIHLSPFSPRKKLRIPQPFEFPFDGTKF
PFFANNNGESMCYLSNDNNNNAPAGIQGARQAQQLFGSPSPSLLSDLNNLNSYSAVNKLH
QSSSPAMFLSGFNPRHHHYDNIVLSRQGRDTEFNNNNNISCSLTMGNPGLVHDKKKSGSV
KTHQFLLFGQPILTEQQVMNRKRSLEEEAEAAQEEKTGSWNYGLQGLETGHCKVFMESED
VGRTLDLSVIGSYQELYRKLAEMFCIEERSDLLTHVVYRDANGVIKRIGDEPFSDFMRAT
KRLTIKMDIGGDNVRKTWITGIRNGENGIDSSTKTGPLSIFA
Download sequence
Identical sequences E4MX11 V4MFJ2
XP_006409860.1.70970 Thhalv10016329m|PACid:20180956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]