SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10017156m|PACid:20181075 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10017156m|PACid:20181075
Domain Number 1 Region: 35-144
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.58e-31
Family B3 DNA binding domain 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10017156m|PACid:20181075
Sequence length 246
Sequence
MSINQYSSDFHYHSLMWQQQQQQHHHQNDVVEEKEALFEKPLTPSDVGKLNRLVIPKQHA
ERYFPLAAAAADAVEKGLLLCFEDEEGKPWRFRYSYWNSSQSYVLTKGWSRYVKEKHLDA
GDVVLFHRHRADGRRFFIGWRRRGDSSSSSESYRHLQSNASLHYPHAGAQAGESQRGNSK
TLRLFGVNMECQLDSDWSEPSTPDGFTTCPTSHDQFHFYPQQHYPPPYFMDISFTGDVHQ
TRSTQE
Download sequence
Identical sequences V4MAS3
XP_006410779.1.70970 Thhalv10017156m|PACid:20181075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]