SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10017854m|PACid:20180436 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10017854m|PACid:20180436
Domain Number 1 Region: 65-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000942
Family B3 DNA binding domain 0.0061
Further Details:      
 
Weak hits

Sequence:  Thhalv10017854m|PACid:20180436
Domain Number - Region: 107-184
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.068
Family beta-sandwich domain of Sec23/24 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10017854m|PACid:20180436
Sequence length 252
Sequence
MVKDMNEYMERVLMDGCEGQQNPNRHDTSSPSLSSVESNEPIRAELIKLLVKRKSPLKEI
RRVNESRRGIHWVVDDRRWNMNTSFIYVLCSGWNKVVNSNKLKEGQIYQAQAMAQAMAQL
QAQDPAQAVTQPQAQDPDDQAVAQALAPAIAAALSSSLAMAPVVTRQYDELNLCEEERNR
SCANFPKRRKTTRVCVPAPTTRDSSNLGQSMLKRLDLDRLVRAPLEAVQETNRRISLLSD
TDMKTLDLLLRL
Download sequence
Identical sequences V4M660
XP_006410301.1.70970 Thhalv10017854m|PACid:20180436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]