SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10018139m|PACid:20192001 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10018139m|PACid:20192001
Domain Number 1 Region: 113-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.58e-48
Family B3 DNA binding domain 0.0057
Further Details:      
 
Domain Number 2 Region: 694-769
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000294
Family PB1 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10018139m|PACid:20192001
Sequence length 801
Sequence
MNLSTSGFGHQSHEGEKKCLNSELWHACAGPLVSLPSSGSRVVYFPQGHSEQVAATTNKE
VEGHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMVLQPLTQEEQKDTFVPIELGIPS
KQPSNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYTQQPPAQELIARDLHDNEWKFR
HIFRGQPKRHLLTTGWSVFVSAKRLVTGDSVIFIRNERNQLLLGIRHASRPQTIVPSSML
SSDSMHIGLLAAAAHAAATNSCFTVFYHPRSSSSEFVLPLPKYIKAVFHTRISVGMRFRM
LFETEESSVRRYMGTITGIGDLDSVRWPNSHWRSVKVGWDESTAGERQARASLWEIEPLT
TFPMYPSLFPLRLKRPWHPGASSMHDSRGDIASGLTWFRGGAGENGMLPLNYPSASLFPW
MQQSLLGTDQNQQYQAMLAAGLQNIGGGDPLRQQFVQLQEPNHQYLQQSASLHNSDLLLQ
QHHQASSQQQLPRHLLQAQTQMTENLPQQNLRQEVSNQVTGQPQQPNRVWQHSDLLSPSF
MKSDFADLNNKFTSTANPVQQQNSTLQGSGDGSNLLNFSITGQSSVHSEQIPTQVWSLKH
SHPETNEFSEPLSLRQAYGGTSPSLEPPNTQNLSLFGVDSDSGLFLPTTVPHFGTLSADA
DTSSMPLTDSGFQNSLYGSMQDTTELLHGAGQTKNFVKVYKSGSVGRSLDISRFSSYHEL
REELGKMFDIKGLLEDAFRSGWQLVFVDKEDDVLLLGDDPWESFVNSVWYIKILSPEDVQ
KMGEHGEGGSNGSYPQNLTHF
Download sequence
Identical sequences E4MW63 V4KG44
Thhalv10018139m|PACid:20192001 XP_006391521.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]