SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10019518m|PACid:20192323 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10019518m|PACid:20192323
Domain Number 1 Region: 18-120
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000143
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10019518m|PACid:20192323
Sequence length 124
Sequence
MAQDQELNLELDLTPYDPRVIKKTLSDTDVSQQGKLNLPRQDFENFIIPEMAGDIIQNLG
NGVKVKVLIYEEEYIVTLKRKSNRSYMLSAGWPALVKTNGFQTNDLIGLCWVSSSSRFYL
QRII
Download sequence
Identical sequences V4KC94
XP_006391438.1.70970 Thhalv10019518m|PACid:20192323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]