SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10020238m|PACid:20182788 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10020238m|PACid:20182788
Domain Number 1 Region: 342-481
Classification Level Classification E-value
Superfamily CBS-domain pair 1.57e-31
Family CBS-domain pair 0.0027
Further Details:      
 
Domain Number 2 Region: 497-608
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.00000000000000273
Family CorC/HlyC domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10020238m|PACid:20182788
Sequence length 660
Sequence
MTGMALELSVLGRSVIGSKTSNLKRYGQKSKLSGRLLPRTELHCPMVLNSSENSNLSLRF
RRSCESSYRSRCMVFSSSQYHEGSQQNSDSGEKELESIKVLLKRGIVIGAVVCGVFLYGC
QKVLASAGVVEAGYEVFGQSLVLFKNALPKIYQVLRVLREQGLILAALLSLSAFFSMAET
SITTLWPWKVRELAEKEPENGVFRMLRSDVTRFLTTILIGTTVVNIAATALVTEAATVIF
GEAGVSAATGLMTVAILLLTEITPKSVAVHNAQEVARIVVRPVAWLSLVLYPVGRIVTYL
SMGILKILGLKGRSEPYVTEDELKLMLRGAELSGAIEEEEQDMIENVLEIKDTHVREVMT
PLVDVVAIDASGSLVDFHSMWVTHQYSRVPVFEQRIDNIVGIAYAMDLLDYVQKGDLLEC
TSVGDMAHKPAYFVPDSMSVWNLLREFRIRKVHMAVVLNEYGGTIGIVTLEDVVEEIVGE
IFDENDSKEEIQKKTGYIVMRDEGIYDVDANTSIDQLSEELNMKMPEDIQYETVSGFVCE
AFGYIPKTGESVKVVLEKENWEEDGEEEEGKQERQEQKEKHQIYRVEILAGNARKVSAVR
FERVNDMDQVSEAKDVKSMVPKFVRKWSSEEDDGNSSYQEKSEHAVSDEHVLADNSKKQQ
Download sequence
Identical sequences V4M1L7
XP_006407264.1.70970 Thhalv10020238m|PACid:20182788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]