SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10021069m|PACid:20183217 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10021069m|PACid:20183217
Domain Number 1 Region: 43-332
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.57e-79
Family Capz alpha-1 subunit 0.0000217
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10021069m|PACid:20183217
Sequence length 343
Sequence
MTNLTPFKSTDGDNKLVSPPSSFPRVIEKAMADEEDELPETELSYDQKKEIAKWFLLNAP
AGEINYVAKDLKAVLRDEEVYSEAAMEAFPVYNKSHLICLEMPSRAGDVIVSSYSEITVN
EYLDPRTAQVAIVDHVKQICTKVRPANDEELPSSYIEEYRYALDAEVQRYVSEAYPKGVS
AVNCVKGKDADGPGTDFELVVIISATKLSPQNFCNGSWRSVWNIDFQDESQVLDIKGKLQ
VGAHYFEEGNVELDAKNEFHDSTIFQSADDCAIAIANIIRHHETEYLAALESLHHQVAYS
KLPDNTFKDLRRKLPVTRTLFPWQNTLQFSLTREVEKELGLGK
Download sequence
Identical sequences V4M3S1
Thhalv10021069m|PACid:20183217 XP_006408064.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]