SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10021087m|PACid:20183218 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10021087m|PACid:20183218
Domain Number 1 Region: 43-327
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.15e-82
Family Capz alpha-1 subunit 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10021087m|PACid:20183218
Sequence length 338
Sequence
MTNLTPFKSTDGDNKLVSPPSSFPRVIEKAMADEEDELPETELSYDQKKEIAKWFLLNAP
AGEINYVAKDLKAVLRDEEVYSEAAMEAFPVYNKSHLICLEMPSRAGDVIVSSYSEITVN
EYLDPRTAQVAIVDHVKQICTKVRPANDEELPSSYIEEYRYALDAEVQRYVSEAYPKGVS
AVNCVKGKDADGPGTDFELVVIISATKLSPQNFCNGSWRSVWNIDFQDESQVLDIKGKLQ
VGAHYFEEGNVELDAKNEFHDSTIFQSADDCAIAIANIIRHHETEYLAALEVAYSKLPDN
TFKDLRRKLPVTRTLFPWQNTLQFSLTREVEKELGLGK
Download sequence
Identical sequences V4NS94
Thhalv10021087m|PACid:20183218 XP_006408063.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]