SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Thhalv10021091m|PACid:20182279 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10021091m|PACid:20182279
Domain Number 1 Region: 96-213
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 5.89e-18
Family N-utilization substance G protein NusG, N-terminal domain 0.0024
Further Details:      
 
Domain Number 2 Region: 280-331
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000552
Family N-utilization substance G protein NusG, C-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10021091m|PACid:20182279
Sequence length 337
Sequence
MIKLQGGLLQWSRSSFIPSINTAINKTHLSISACVVERNHQLTARERRQLRNERRESKSG
YSWREEVEERLIKKPKKRYASWTEELNLDTLAESGPQWWVVRVSRLRGQETAQVLARALA
RQFPEMEFKVYAPAVQVKRKLKNGTLSVKPKPVFPGCIFIRCILNKEIHDSIRECDGVGG
FIGSKVGNTKRQINKPRPVDDSDLEAIFKQAKEEQEKADSEFEEAQRAEEEASLASQKLL
ASNSDVLETVESLSETKPKRSPRKATLAAETKDPKGKKKKLAAGSTVRVLSGTFAEFVGN
LKKLNRKTAKATVGFTLFGKETLVEIDINELVPETQS
Download sequence
Identical sequences V4M2R9
XP_006407704.1.70970 Thhalv10021091m|PACid:20182279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]