SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10021356m|PACid:20183715 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10021356m|PACid:20183715
Domain Number 1 Region: 8-104
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000314
Family B3 DNA binding domain 0.0092
Further Details:      
 
Domain Number 2 Region: 158-243
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000844
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10021356m|PACid:20183715
Sequence length 259
Sequence
MLPKSENQSKPSFSKSLSLGQNWKSKSMRMIPEEFVRSIKHRLVFSVHWGNSWQLWLQGD
KKGLFMVKEDWDEFVDDNLLGPDDTLLFTHQDTMHFQVRIFKKDGKEINSVPLEVETGTE
PFHPKPRNSLQEATPGKRRPGRAGKNCSDVENLKRYLVNPQNPFFKKTLTKTNHILYVSS
WVIEKYGLEFAPHNSEMYFHLPHGTKHKGFTKFYGRSHGFNGWEEVSERYNLKVGDSVVC
ELELSGGVVAAVRVHFLNE
Download sequence
Identical sequences V4LWD5
XP_006406671.1.70970 Thhalv10021356m|PACid:20183715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]