SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10021527m|PACid:20183453 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10021527m|PACid:20183453
Domain Number 1 Region: 24-124
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-24
Family B3 DNA binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10021527m|PACid:20183453
Sequence length 208
Sequence
MVTTRGTQARVTAVSHRRPPTKPESPVKNFFKVVLPSTMKSNMMRIPTRFVKLQGSKLSE
VVTLESPVGFKRSIKLKRIGEEIWFQEGWSEFAEAHSISEGHFLIFKYKGNSSFLVTIFD
VSACEIDYPLDEVHISDSDDEVVDITDAEFLPTQGTGGDDQSVKGGASEDKRKNRPRDNE
FEKILNDVDGINPIVLEEEEEEKRVFRE
Download sequence
Identical sequences V4LW15
XP_006406546.1.70970 Thhalv10021527m|PACid:20183453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]