SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10022043m|PACid:20183918 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10022043m|PACid:20183918
Domain Number 1 Region: 24-126
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-17
Family B3 DNA binding domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10022043m|PACid:20183918
Sequence length 131
Sequence
MAQDQEHNQDEELNLELGLALYDPWVIKKTLYDSDVSQQGRLNLPRQDFEDFIIPEMAGD
LVQNLGNGVKVKALVVDEEEHIVTFKRKSNGSYILCAGWSAIVKANNFQTNDLIGFCWVN
SSDRFYLQRIN
Download sequence
Identical sequences V4LBS4
Thhalv10022043m|PACid:20183918 XP_006406442.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]