SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10022138m|PACid:20181474 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10022138m|PACid:20181474
Domain Number 1 Region: 15-118
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-18
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 2 Region: 218-308
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.49e-17
Family B3 DNA binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10022138m|PACid:20181474
Sequence length 321
Sequence
MGRNRGFDRIKDERKDLSFFKIFQSADLSSECMRAIPYNFMKGLSNKDFSYKMVIRAQWG
SSWEVEVSKNPRFYYIEKPGWNQFVSDLALGDNEFVTFTHKGKMCFNVNIYQQDGKELVM
PPTMAPSSGIKKEQGESSHADVKKEVETGESMGGEELKVRKKKSEESKTYKKMKSKNVVN
SVEIGESSRGVEHKVIKKNAEKAKTSKKREITSCKVKNGVPEFTITIRKSYLKFLSIPKR
FGEEHIPNESMIFTIHHSKGSGSWRVLCLVREARTVFSSGWSKLAREYPLLVGDKCTLKL
IKPTELLLISKKARENISMIG
Download sequence
Identical sequences V4M0A5
Thhalv10022138m|PACid:20181474 XP_006406779.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]