SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10022336m|PACid:20182221 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10022336m|PACid:20182221
Domain Number 1 Region: 7-107
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-20
Family B3 DNA binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 141-230
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.67e-17
Family B3 DNA binding domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10022336m|PACid:20182221
Sequence length 389
Sequence
MENATAFSPTNPHFFQPLLPGFHSHLNIPMAFFSKHLEGTTNLDNAVVKLRSDASDITWE
VKMDGRRLTQGWQNFATSHDLRVGDIVIFRHDGDLLFNVTSFGPSCCEIQYDDDDVVQIA
SVETDSDPDKYQHTREAGSSSDHSCFLARVTASNLSKDLLFLPMDFARSNGLMNRHCETI
LLNEDGKPWTLFLKYTKKTQSRAYIARGWRSFCRANEKRANCLLTFKLVQTEMGKDSQKS
QTADSTQPLSLESLSHTLMQSITSQVEFEKQTTLQFASIDSKFSELIAVLKKGSDRKDEV
LEFSNPNYSSQARQVRFPDSATDNHHRSTDSSTGNTIINSREGMLKRIDLPVFDGADVYG
WIALAERFFQNWRLSRRCKARNRLDQFGW
Download sequence
Identical sequences V4M958
XP_006407475.1.70970 Thhalv10022336m|PACid:20182221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]