SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10022721m|PACid:20202263 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10022721m|PACid:20202263
Domain Number 1 Region: 97-391
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 1.1e-94
Family Transcriptional factor tubby, C-terminal domain 0.0000115
Further Details:      
 
Domain Number 2 Region: 41-105
Classification Level Classification E-value
Superfamily F-box domain 0.00000222
Family F-box domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10022721m|PACid:20202263
Sequence length 392
Sequence
MSLKSILRDLKEVRDGLGGISKRSWSKSSHIAPDQTTPPPENIPQSPWASLPPELLHDII
RRVEESETAWPARAAVVSCASVCKSWRGITMEIVRVPEHCGKLTFPISLKQPGPRDSPIQ
CFIKRNRATGTYLLYYGLMPSETENDKLLLAARRVRRATCTDFIISLSVKNFSRRSSTYV
GKLRSGFLGTNFTIYDNQTASSTAQAQPNRRLHSKQASPKLPATSYTAGNITYELNVLRT
RGPRRMHCVMESILLSSVLAAPLVVKGSKEEVSPSPKGEASSTDREITDVSPSLMDQPLV
LKNKSPRWHEQLQCWCLNFKGRVTVASVKNFQLVADIDPSLNAPPEEHDRVILQFGKIGK
DIFTMDYRYPLSAFQAFAICISSFDTKPACEG
Download sequence
Identical sequences E4MVR4 V4M361
Thhalv10022721m|PACid:20202263 XP_006409171.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]