SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10023005m|PACid:20202014 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10023005m|PACid:20202014
Domain Number 1 Region: 5-93
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000129
Family B3 DNA binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10023005m|PACid:20202014
Sequence length 107
Sequence
MDPSLMIEKTLTDTDICWKGRLRLPKLIINNIVKKMGVVIPQNGIQVEIQDCDKSNWVNF
GHNNTIGNGWNNMRNARGLKRGDVIRLYWKDTKFIFSMPSLLLFLFL
Download sequence
Identical sequences V4NVD4
Thhalv10023005m|PACid:20202014 XP_006409323.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]