SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10023365m|PACid:20201726 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10023365m|PACid:20201726
Domain Number 1 Region: 267-370
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.44e-17
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 66-191
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000173
Family BTB/POZ domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10023365m|PACid:20201726
Sequence length 593
Sequence
MDTIAGFADSYEISNTSSTSFFAAAPAPTDNTESSTVCPAEFLTGPDVSALQLLSNSLES
VFDSPEDFYSDAKLILAGGREVPFHRCLLAARSPFFRNALAAVKNSAAVKLELKEIAKDH
QVGFDSVVAVLSYIYSGRVKPPPKGVSDCAYENCCHVACRPAVDFMVEVLYLAFVFEIPE
LVTLYQRHLLDVVDKAFVEDTLVILKLANICGKACEKLTDRCKEIIVKSDVDLVTLDKSL
PQHIVKEITKIRKELGFEVPELEKHVSNIYKALDSDDVELVKMLLKEGHTNLDDAYALHF
AVAYCDVKTATDLLDLELADVNCRNPRGYTVLHVAAMRKEPKLIASLLTKGANASDTSLE
GRTALLIAKQVTMAAEYNNVTERCKPSLKGRLCVEILEQADKGDPFPRDVSPSLAMAGHE
LKSRLLDLENRVALARRLFPMEAQVAMDIAQMKGTCEFIGTNHEHERLTGAKRTSPDVKI
APFEILEEHQSRLKALSKTVELGKRFFPRCSAVLDSIMDCEDLTQLACEGEDTPEKRIQK
KQRYMEIQETVKKAFSEDKEEFGNSSLSASSSSTSKSTAGKKRSNGKLSHRRR
Download sequence
Identical sequences V4KCR1
XP_006391648.1.70970 Thhalv10023365m|PACid:20201726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]