SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10024554m|PACid:20195557 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10024554m|PACid:20195557
Domain Number 1 Region: 182-320
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-38
Family B3 DNA binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 591-672
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000147
Family PB1 domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10024554m|PACid:20195557
Sequence length 707
Sequence
MVVVGFKASCLFISLKGAEVVKTYVIASSLNRRERRLKSKVFVCLVIERSFNQLWIFGFL
TLRRAAGYKLELMANRGGDGGGEHLYDELWKLCAGPLVNVPQAEERVYYFPQGHMEQLEA
STQQDLNTMKPLFNLPPKILCRVMNVRLQAEKDTDEVYAQITLIPEGTQVDEPMSPDPSP
PETQRPKVHSFSKVLTASDTSTHGGFSVLRKHATECLPPLDMTQQTPTQELVAEDVHGYQ
WKFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFLRGENGELRVGVRRANRQQSSMP
SSVISSHSMHLGVLATACHATQTRTMFTVYYKPRTSQFIISLNKYLEAMTNKFSVGMRFK
MRFEGEDSPERSFSGTVVGGKDCSPHWKDSKWRCLEVHWDEPASISRPDKVSPWEIEPFV
TSENVPQSVVLKNKRPRQVSEVSALGITASNLWSSALTQSHEFAQSCITSQRNSPKQYYR
DAIEDAKNPDWPISPYSVSNVSKDSTLNDQMVFPVKQKKPETTASYRLFGIDLMSSSIAA
SEEKTAAMRPINITKPTPESNSDPKSEISKVSEEKKQEPAQASPKEVQSKQSSSTRSRTK
VQMQGVPVGRAVDLTVLSGYSELIDDLEKLFDIKDELRSRSQWEIVFTDDEGDMMLVGDD
PWPEFCNMVKRIFIWSKEEVKKMTPGNQLRMLLTEVETASKTDNHSD
Download sequence
Identical sequences V4MHZ3
XP_006413489.1.70970 Thhalv10024554m|PACid:20195557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]