SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Thhalv10024601m|PACid:20195479 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10024601m|PACid:20195479
Domain Number 1 Region: 115-223
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.72e-30
Family B3 DNA binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  Thhalv10024601m|PACid:20195479
Domain Number - Region: 589-660
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0235
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Thhalv10024601m|PACid:20195479
Sequence length 672
Sequence
MINVMNPMKGGSEKGLDPQLWHACAGGMVRMPPMNSKVFYFPQGHAENAYDCVDFGNLPI
PPMVLCRVLAIKYMADAESDEVFAKLRLIPLKDDEFVDHEYVDGEDSNGFDSNSEKTPSF
AKTLTQSDANNGGGFSVPRYCAETIFPRLDYNAEPPVQTILAKDVHGDVWKFRHIYRGTP
RRHLLTTGWSNFVNQKKLVAGDSIVFMRAENGDLCVGIRRAKRGGIGNGPEYSAGWNPIG
GSCGYSSLLREDESNSLRRSNCSLADRKGKVTSESVIEAATLAITGRPFEVVYYPRASTS
EFCVKALDVRAAMRIPWCSGMRFKMAFETEDSSRISWFMGTVSAVNVSDPIRWPNSPWRL
LQVAWDEPDLLQNVKRVNPWLVELVSNVHPIPLTSFSPPRKKMRLPQHTDYNNLINSIPV
PSFPSNPLIRSSPLSSVLDNVPVGLQGARHNAHQYYGLSSSDLHHYYLNGPPPSHPPPPA
TSSLPLSPPLGLRNIDSRNEKGFCFLTMGTAPCNDTEAKKSHIVLFGKLILPEEQISGST
DTANVEKTQISSGGSNQNCVAGRELSSSDEGSPCSNKVHDAGGLETGHCKVFMESDDVGR
TLDLSVLGSYEELNRKLSDMFGIQNSEMLSSVLYRDASGAIKYAGNEPFSEFLKTARRLT
ILTEQGSESVVI
Download sequence
Identical sequences V4MCQ2
XP_006412761.1.70970 Thhalv10024601m|PACid:20195479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]